PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10038261
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 308aa    MW: 34709.4 Da    PI: 6.1364
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10038261genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.62.7e-4071061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk++rrkC+++C++ap+fp +qp+kfa +hk+FGasnv kll++lp+  re+a+ sl yeA ar+rdPvyG+vg i++lq++l+q + e+++++
  Lus10038261   7 PCAACKLQRRKCTQECIFAPHFPPDQPQKFADIHKVFGASNVAKLLSELPTMSREEAVISLSYEAGARIRDPVYGCVGAISELQHRLKQIHMEIDATR 104
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Lus10038261 105 QE 106
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.5676107IPR004883Lateral organ boundaries, LOB
PfamPF031955.5E-407104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSHSQQPCAA CKLQRRKCTQ ECIFAPHFPP DQPQKFADIH KVFGASNVAK LLSELPTMSR  60
EEAVISLSYE AGARIRDPVY GCVGAISELQ HRLKQIHMEI DATRQELLKY MGPNNQQQDQ  120
AFMIPNLATA SFIAPSTHHQ NQQQQQQNMM MQMMGRGGGG HQMLEAQLMA TELNSTTDRG  180
EQLQQQQHHE MFRVYEQREQ QQQQQHHNQH EVIGFSNGNG IMDDHVPNSI GFNQISIGEV  240
EPCLALGSMD DQNSHHHQQQ VNNEQSQVEI PVHHEQLFFH SEHHEPDLNH HQSSGSDEGG  300
NSGPSLS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.16e-53ASYMMETRIC LEAVES 2-like 1